PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G103600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 1707aa    MW: 186817 Da    PI: 6.2616
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G103600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-09798839346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT+eE e+++d  +++G++ +++Ia+ +  ++t  +c+++++k
  Manes.07G103600.1.p 798 PWTAEEREIFIDKLAMFGKD-FRKIASFLD-HKTTADCVEFYYK 839
                          8*****************99.*********.***********98 PP

2Myb_DNA-binding30.96.4e-1010121051445
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                           WT eE  ++++av  +G++ ++ I++++  +R++ qck ++ 
  Manes.07G103600.1.p 1012 WTDEEKSIFIRAVSSYGKD-FSMISQCVR-TRSRDQCKMFFS 1051
                           *****************99.*********.********7775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-14782842IPR009057Homeodomain-like
PROSITE profilePS5129317.124794845IPR017884SANT domain
SMARTSM007176.8E-10795843IPR001005SANT/Myb domain
PfamPF002494.9E-7797839IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-6798839IPR009057Homeodomain-like
PROSITE profilePS5129311.02110071058IPR017884SANT domain
SMARTSM007171.8E-810081056IPR001005SANT/Myb domain
SuperFamilySSF466891.17E-1010111058IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-710111052IPR009057Homeodomain-like
PfamPF002498.5E-810121050IPR001005SANT/Myb domain
CDDcd001671.92E-710121050No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1707 aa     Download sequence    Send to blast
MPTERLSWDR KELAKERKYD RSKARWRESS SSHYGSYRDF ARWGGSNEFR RPPGHGKQGG  60
WHLFAEESVH AYAPFRSSDR ILEEKNCRPS LSRGDGKYGR NGRDNRGSFS QRDWRAHSWE  120
MSNGSPNTPG RPFDASNDQR LVDDTVTYPS SHPHSEFLNT WGQAHPKDQH DNSTMVVVNG  180
LGTGQRSDRE NSLDWKPLNK WTHSGSLSSR GSGFSHSSSS KSLGGADSFE GKAELQLRNA  240
SLVTSHSGDA VARVTSAPSE EIAARKKPRL NWGEGLAKYE KKKVEGPEVN VSKDGVISSS  300
NMEANHSQSS NLIEKSPRVV GLSDCASPAT PSSVACSSPG LEEKTFGKGI NADNDISNLC  360
CSPSIGSQSH IEGFSFTEVL DATSIANLGA SLVELLQCDD SSSADSSFVR STAMNKLLTL  420
KGGISKTLEV TESEIDLLEN ELKSLKFECG GRFPCPAAAS YCSVGDEAKL CSGQVIGSNN  480
IPRPSPFQAS SCGTGHVENI PICNGLLEVV HGCGKDDDVD SPGTATSKFV GSVSSVIGVS  540
SSDLGKQDEC SGFMGVIQSP TMVLKSVVPC TSEQDIDEHA SMDVNMLTKN KESAFFPSDS  600
SSEENICNPI LAANKKSASK ASNIFINLLP RDECEVVFSE VANVALRQKD ALVKERFAMR  660
KQFLKFKERV VTLKYKAFQH LWKEDMRFLS IRKYRAKPQK KYELSLRTTH SGNQKNRSSI  720
RSRFPFPVGN LSLVPSTEML NFTSKLLQVS RVKLYRNALK MPMLILDKKE RKASCFISSN  780
GLIEDPCAVE KERAMINPWT AEEREIFIDK LAMFGKDFRK IASFLDHKTT ADCVEFYYKN  840
HKSDCFEKTK KRKQAKSSTN YLVASGKNWN RQVNAASLDI LGAASVMAAD ADNCMENQRM  900
CAGRFYLGGY CDSRTSHGDD GNLDRLSNFH ILENERETVA ADVLAGICGS VSSEAMSSCI  960
TTSVDPVEGC QERKSQKVDS VKKRPSTSDI TENVDEETCS YESCGEMDPA DWTDEEKSIF  1020
IRAVSSYGKD FSMISQCVRT RSRDQCKMFF SKARKCLGLD SVHPGPENLG TPASDDANGG  1080
GSDTEDGGAV ESGLMICSNQ LHTKIDDNVP LPHKDAKQHE ESFAMERKEL TTDLNGSKDS  1140
NVAELSGPKV EKMLVSDACW MMENKPELAS NFHKIMNGFV HQSEFMLAQE VSNESVNSEA  1200
GIEKLVDDNI PVEDAGDLGP SNPVADADVK GIAEASANAS VNSLVEKELL LPENNLNNGT  1260
DDSGNVSHQP LDMGCCPNFI VGVENVHHIS VELDPVDKSP IVSSTHENKL VTASSVLQDS  1320
AGIECRKLHN QDRSSSQFDF QKNKDEQGKK SVGEDDHLGI LGSYPFQIPT EREMNGDMSC  1380
RPHSELESLS ASERNATNQF AAQDCYLQKC SNSKAQCLMP ELPLLSQHPG QGNGQPRDQS  1440
CSSSHIEKPC RNGDVKLFGT ILTNPSSSSK LNSSINGNIE QLTEGPKPGN KSSILKFTGH  1500
PTIDGSSSIV KFDCNNHLGP DNVPMKRYDF WDGKKIQTGF SSLPLLANYP AAYGNYDVTS  1560
SKIEQPALQA SVKCDDRNLN SVSALPPREI SSSSSSSSNG VIDYQTYRSR DNSKVEAFSV  1620
DMLQRHDIFN ELQRRNGLEA VSILQQQRQG RGTRMNVVGR GGIIVGGSCT EVSDPVAALK  1680
MQYGGKNGSI TGEDESWRTR KDDVGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14756847494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14756847494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086506.10.0PREDICTED: uncharacterized protein LOC105645502
TrEMBLA0A067K1T60.0A0A067K1T6_JATCU; Uncharacterized protein
STRINGPOPTR_0010s22670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-163MYB family protein